PDB entry 1e2x

View 1e2x on RCSB PDB site
Description: fadr, fatty acid responsive transcription factor from e. coli
Class: transcriptional regulation
Keywords: transcriptional regulation
Deposited on 2000-05-30, released 2000-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid metabolism regulator protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2xa1, d1e2xa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2xA (A:)
    fadrmvikaqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrla
    rdgwltiqhgkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirta
    frqhpdkaqevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrig
    rhyfanpearslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknlpgdlai
    qgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2xA (A:)
    qspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqh
    gkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaq
    evlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpea
    rslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmq