PDB entry 1e2w

View 1e2w on RCSB PDB site
Description: n168f mutant of cytochrome f from chlamydomonas reinhardtii
Deposited on 2000-05-30, released 2000-08-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-04, with a file datestamp of 2000-08-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2wA (A:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnftiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2wB (B:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnftiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar