PDB entry 1e2u

View 1e2u on RCSB PDB site
Description: Low Temperature Structure of Hybrid Cluster Protein from Desulfovibrio vulgaris to 1.6A
Class: oxidoreductase
Keywords: oxidoreductase, cubane, iron sulfur, fuscoredoxin
Deposited on 2000-05-26, released 2000-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxylamine reductase
    Species: DESULFOVIBRIO VULGARIS [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2ua_
  • Heterogens: SF4, FSO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2uA (A:)
    mfcfqcqetakntgctvkgmcgkpeetanlqdllifvlrgiaiygeklkelgqpdrsndd
    fvlqglfatitnanwddarfeamiseglarrdklrnaflavykakngkdfseplpeaatw
    tgdstafaekaksvgilatenedvrslrelliiglkgvaayaehaavlgfrkteidefml
    ealasttkdlsvdemvalvmkaggmavttmalldeantttygnpeitqvnigvgknpgil
    isghdlkdmaellkqtegtgvdvythgemlpanyypafkkyphfvgnyggswwqqnpefe
    sfngpillttnclvplkkentyldrlyttgvvgyegakhiadrpaggakdfsaliaqakk
    cpppveietgsivggfahhqvlaladkvveavksgaikrfvvmagcdgrqksrsyyteva
    enlpkdtviltagcakyrynklnlgdiggiprvldagqcndsyslavialklkevfgldd
    indlpvsydiawyeqkavavllallflgvkgirlgptlpaflspnvakvlvenfnikpig
    tvqddiaammagk