PDB entry 1e2t

View 1e2t on RCSB PDB site
Description: arylamine n-acetyltransferase (nat) from salmonella typhimurium
Deposited on 2000-05-24, released 2000-07-07
The last revision prior to the SCOP 1.65 freeze date was dated 2000-07-07, with a file datestamp of 2000-07-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.264
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1e2ta_
  • Chain 'B':
    Domains in SCOP 1.65: d1e2tb_
  • Chain 'C':
    Domains in SCOP 1.65: d1e2tc_
  • Chain 'D':
    Domains in SCOP 1.65: d1e2td_
  • Chain 'E':
    Domains in SCOP 1.65: d1e2te_
  • Chain 'F':
    Domains in SCOP 1.65: d1e2tf_
  • Chain 'G':
    Domains in SCOP 1.65: d1e2tg_
  • Chain 'H':
    Domains in SCOP 1.65: d1e2th_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2tA (A:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tA (A:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2tB (B:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tB (B:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e2tC (C:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tC (C:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e2tD (D:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tD (D:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e2tE (E:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tE (E:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e2tF (F:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tF (F:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1e2tG (G:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tG (G:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1e2tH (H:)
    gshmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetale
    ekllyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvede
    qwiadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlg
    vqqqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvp
    dvpslyqllqqqfglgvndvkhgfteaelaavmaafdthpeagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2tH (H:)
    hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
    llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
    iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
    qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
    pslyqllqqqfglgvndvkhgfteaelaavmaaf