PDB entry 1e2r

View 1e2r on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, reduced and cyanide bound
Deposited on 2000-05-24, released 2000-05-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-03, with a file datestamp of 2000-10-03.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2rA (A:)
    dvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylq
    sfityaspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemreswkvhvapedr
    ptqqendwdlenlfsvtlrdagqialidgstyeiktvldtgyavhisrlsasgrylfvig
    rdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywppqyvimdget
    lepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillvdytdlnnlkt
    teisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtggqtphpgrganf
    vhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfikthpnsqyly
    vdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprvvqgefnkdgt
    evwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2rB (B:)
    yepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpd
    ltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemre
    swkvhvapedrptqqendwdlenlfsvtlrdagqialidgstyeiktvldtgyavhisrl
    sasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagayw
    ppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkill
    vdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtgg
    qtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslf
    ikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqpr
    vvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmt
    dty