PDB entry 1e2r

View 1e2r on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, reduced and cyanide bound
Class: oxidoreductase
Keywords: oxidoreductase, denitrification, electron transport, periplasmic, cyanide
Deposited on 2000-05-24, released 2000-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72181 (Start-566)
      • conflict (184)
      • conflict (190)
      • conflict (330)
    Domains in SCOPe 2.07: d1e2ra1, d1e2ra2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72181 (Start-566)
      • conflict (184)
      • conflict (190)
      • conflict (330)
    Domains in SCOPe 2.07: d1e2rb1, d1e2rb2
  • Heterogens: HEC, DHE, CYN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2rA (A:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgstyeiktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2rA (A:)
    dvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylq
    sfityaspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemreswkvhvapedr
    ptqqendwdlenlfsvtlrdagqialidgstyeiktvldtgyavhisrlsasgrylfvig
    rdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywppqyvimdget
    lepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillvdytdlnnlkt
    teisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtggqtphpgrganf
    vhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfikthpnsqyly
    vdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprvvqgefnkdgt
    evwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2rB (B:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgstyeiktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2rB (B:)
    yepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpd
    ltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemre
    swkvhvapedrptqqendwdlenlfsvtlrdagqialidgstyeiktvldtgyavhisrl
    sasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagayw
    ppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkill
    vdytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtgg
    qtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslf
    ikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqpr
    vvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmt
    dty