PDB entry 1e2q

View 1e2q on RCSB PDB site
Description: human thymidylate kinase complexed with tp5a and a magnesium-ion
Deposited on 2000-05-23, released 2001-05-17
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-17, with a file datestamp of 2001-05-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e2qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e2qA (A:)
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplgelwk