PDB entry 1e2p

View 1e2p on RCSB PDB site
Description: thymidine kinase, dhbt
Class: transferase
Keywords: transferase, kinase, DNA synthesis, ATP-binding
Deposited on 2000-05-23, released 2001-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS TYPE 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03176 (0-End)
      • conflict (275)
    Domains in SCOPe 2.07: d1e2pa_
  • Chain 'B':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS TYPE 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03176 (0-End)
      • conflict (275)
    Domains in SCOPe 2.07: d1e2pb_
  • Heterogens: SO4, CCV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2pA (A:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2pA (A:)
    mptllrvyidgphgmgkttttqllrddivyvpepmtywrvlgasetianiyttqhrldqg
    eisagdaavvmtsaqitmgmpyavtdavlaphiggeagsppaltlifdrhpiaallcypa
    arylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamlaa
    irrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngdlynvfa
    waldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlartfa
    remge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2pB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2pB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsppaltlifdrhpiaal
    lcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrldlamlaai
    rrvygllantvrylqcggswredwgqlsgpqsnagprphigdtlftlfrapellapngdl
    ynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdl
    artfaremge