PDB entry 1e2o

View 1e2o on RCSB PDB site
Description: catalytic domain from dihydrolipoamide succinyltransferase
Class: transferase
Keywords: transferase, acyltransferase, ketoglutarate dehydrogenase multienzyme complex
Deposited on 1998-05-26, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide succinyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: SUCB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2oa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2oA (A:)
    arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
    gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstprglvtpvlrdvdtlgm
    adiekkikelavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaik
    drpmavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2oA (A:)
    arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
    gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstglvtpvlrdvdtlgmad
    iekkikelavkgdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaikdrp
    mavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv