PDB entry 1e2n

View 1e2n on RCSB PDB site
Description: hpt + hmtt
Class: transferase
Keywords: transferase, null
Deposited on 2000-05-23, released 2001-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2na_
  • Chain 'B':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2nb_
  • Heterogens: SO4, RCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2nA (A:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2nA (A:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsppaltlifdrhpiaal
    lcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldl
    amlaairrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngdl
    ynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdl
    artfaremge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2nB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2nB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsppaltlifdrhpiaal
    lcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakldlamlaair
    rvygllantvrylqcggswredwgqlsgpqsnagprphigdtlftlfrapellapngdly
    nvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdla
    rtfaremge