PDB entry 1e2k

View 1e2k on RCSB PDB site
Description: kinetics and crystal structure of the wild-type and the engineered y101f mutant of herpes simplex virus type 1 thymidine kinase interacting with (north)-methanocarba-thymidine
Class: transferase
Keywords: transferase, thymidine kinase, antiviral drug, enzyme-prodrug gene therapy, x-ray structure, sugar ring pucker
Deposited on 2000-05-23, released 2000-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1/ STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2ka_
  • Chain 'B':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1/ STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2kb_
  • Heterogens: SO4, TMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2kA (A:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2kA (A:)
    mptllrvyidgphgmgkttttqllvaddivyvpepmtywrvlgasetianiyttqhrldq
    geisagdaavvmtsaqitmgmpyavtdavlaphiggeagpppaltlifdrhpiaallcyp
    aarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamla
    airrvygllantvrylqcggswredwgqlsgtgprphigdtlftlfrapellapngdlyn
    vfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlar
    tfaremge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2kB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2kB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeahapppaltlifdrhpiaa
    llcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrerldlaml
    aairrvygllantvrylqcggswredwgqlsgtavpqsnagprphigdtlftlfrapell
    apngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsi
    pticdlartfaremge