PDB entry 1e2j

View 1e2j on RCSB PDB site
Description: The nucleoside binding site of Herpes simplex type 1 thymidine kinase analyzed by X-ray crystallography
Class: transferase
Keywords: transferase, adenine analog, enzyme-prodrug gene therapy, nucleoside- binding, thymidine kinase
Deposited on 2000-05-23, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1/STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03176 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d1e2ja_
  • Chain 'B':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1/STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03176 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d1e2jb_
  • Heterogens: SO4, THM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2jA (A:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsanitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2jA (A:)
    mptllrvyidgphgmgkttttqllrddivyvpepmtywrvlgasetianiyttqhrldqg
    eisagdaavvmtsanitmgmpyavtdavlaphiggeagspppaltlifdrhpiaallcyp
    aarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamla
    airrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngdlynvf
    awaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlartf
    aremge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2jB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsanitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2jB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsanitmgmpyavtdavlaphiggeagspppaltlifdrhpiaa
    llcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrldlamlaa
    irrvygllantvrylqcggswredwgqlsgtavpqsnagprphigdtlftlfrapellap
    ngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipt
    icdlartfaremge