PDB entry 1e2h

View 1e2h on RCSB PDB site
Description: the nucleoside binding site of herpes simplex type 1 thymidine kinase analyzed by x-ray crystallography
Class: transferase
Keywords: transferase, adenine analog, enzyme-prodrug gene therapy, nucleoside- binding, thymidine kinase, x-ray crystallography
Deposited on 2000-05-23, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2ha_
  • Chain 'B':
    Compound: Thymidine kinase
    Species: HERPES SIMPLEX VIRUS (TYPE 1 / STRAIN 17) [TaxId:10299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2hb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2hA (A:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2hA (A:)
    mptllrvyidgphgmgkttttqllrddivyvpepmtywrvlgasetianiyttqhrldqg
    eisagdaavvmtsaqitmgmpyavtdavlaphiggeagspppaltlifdrhpiaallcyp
    aarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamla
    airrvygllantvrylqcggswredwgqlsgprphigdtlftlfrapellapngdlynvf
    awaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlartf
    aremge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2hB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
    iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
    rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
    dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
    gmvqthvttpgsipticdlartfaremgean
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2hB (B:)
    mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
    rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagspppaltlifdrhpiaa
    llcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrldlamlaa
    irrvygllantvrylqcggswredwgqlsgpqsnagprphigdtlftlfrapellapngd
    lynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticd
    lartfaremge