PDB entry 1e2g

View 1e2g on RCSB PDB site
Description: human thymidylate kinase complexed with adp, tdp and a magnesium-ion
Deposited on 2000-05-22, released 2001-05-17
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-21, with a file datestamp of 2002-02-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e2ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2gA (A:)
    rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
    ieavhedirvlsedaiatatekplgelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2gA (A:)
    rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakrgeryengafqeralrcfhqlmkdttlnwkmvdasksieav
    hedirvlsedaiatatekplgelwk