PDB entry 1e2g

View 1e2g on RCSB PDB site
Description: Human thymidylate kinase complexed with ADP, TDP and a magnesium-ion
Class: transferase
Keywords: transferase, p-loop
Deposited on 2000-05-22, released 2001-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23919 (Start-214)
      • engineered mutation (202)
    Domains in SCOPe 2.08: d1e2ga_
  • Heterogens: TMP, ADP, TYD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2gA (A:)
    gshmaarrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssyl
    qkksdvedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwc
    kqpdvglpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkm
    vdasksieavhedirvlsedaiatatekplgelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2gA (A:)
    rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakrgeryengafqeralrcfhqlmkdttlnwkmvdasksieav
    hedirvlsedaiatatekplgelwk