PDB entry 1e2d

View 1e2d on RCSB PDB site
Description: human thymidylate kinase complexed with thymidine monophosphate, adenosine diphosphate and a magnesium-ion
Class: phosphotransferase
Keywords: phosphotransferase, thymidylate kinase, p-loop
Deposited on 2000-05-22, released 2001-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.201
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E2D
      • engineered mutation (202)
      • conflict (185-186)
      • conflict (192-193)
    • Uniprot P23919 (Start-214)
    Domains in SCOPe 2.07: d1e2da_
  • Heterogens: TMP, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2dA (A:)
    gshmaarrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssyl
    qkksdvedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwc
    kqpdvglpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkm
    vdasksieavhedirvlsedaiatatekplgelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2dA (A:)
    rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
    ieavhedirvlsedaiatatekplgelwk