PDB entry 1e2c

View 1e2c on RCSB PDB site
Description: destruction of mitotic cyclins
Class: ubiquitin conjugation
Keywords: ubiquitin conjugation, ubiquitin carrier protein, thioester bond, ligase
Deposited on 1998-08-28, released 1998-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 1999-03-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin conjugating enzyme
    Species: SPISULA SOLIDISSIMA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB U52949
    Domains in SCOPe 2.06: d1e2ca_
  • Chain 'B':
    Compound: ubiquitin conjugating enzyme
    Species: SPISULA SOLIDISSIMA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB U52949
    Domains in SCOPe 2.06: d1e2cb_
  • Chain 'C':
    Compound: ubiquitin conjugating enzyme
    Species: SPISULA SOLIDISSIMA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB U52949 (123-155)
    Domains in SCOPe 2.06: d1e2cc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2cA (A:)
    mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
    tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
    pnnasplnaqaadmwsnqteykkvlhekyktaqsdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2cB (B:)
    mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
    tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
    pnnasplnaqaadmwsnqteykkvlhekyktaqsdk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2cC (C:)
    mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
    tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
    pnnasplnaqaadmwsnqteykkvlhekyktaqsdk