PDB entry 1e2b

View 1e2b on RCSB PDB site
Description: nmr structure of the c10s mutant of enzyme iib cellobiose of the phosphoenol-pyruvate dependent phosphotransferase system of escherichia coli, 17 structures
Class: transferase
Keywords: enzyme iib-cellobiose, phosphotransferase system, transferase, sugar transport, phosphorylation
Deposited on 1996-11-15, released 1997-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: enzyme iib-cellobiose
  Species: Escherichia coli [TaxId:83333]
  Gene: CELA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69795 (0-105)
    • engineered (9)
  Domains in SCOPe 2.08: d1e2ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e2bA (A:)
  mekkhiylfssagmstsllvskmraqaekyevpviieafpetlagekgqnadvvllgpqi
  aymlpeiqrllpnkpvevidsllygkvdglgvlkaavaaikkaaan