PDB entry 1e2a

View 1e2a on RCSB PDB site
Description: enzyme iia from the lactose specific pts from lactococcus lactis
Class: transferase
Keywords: enzyme iia, helical bundles, pts, transferase, phosphotransferase system
Deposited on 1997-04-25, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enzyme iia
    Species: Lactococcus lactis [TaxId:1358]
    Gene: LACF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2aa_
  • Chain 'B':
    Compound: enzyme iia
    Species: Lactococcus lactis [TaxId:1358]
    Gene: LACF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2ab_
  • Chain 'C':
    Compound: enzyme iia
    Species: Lactococcus lactis [TaxId:1358]
    Gene: LACF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2ac_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2aA (A:)
    mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
    lareasgeelpysvtmmhgqdhlmttillkdvihhlielykrgak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2aA (A:)
    mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
    lareasgeelpysvtmmhgqdhlmttillkdvihhlielykr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2aB (B:)
    mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
    lareasgeelpysvtmmhgqdhlmttillkdvihhlielykrgak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2aB (B:)
    mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
    lareasgeelpysvtmmhgqdhlmttillkdvihhlielykr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e2aC (C:)
    mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
    lareasgeelpysvtmmhgqdhlmttillkdvihhlielykrgak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2aC (C:)
    mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
    lareasgeelpysvtmmhgqdhlmttillkdvihhlielykr