PDB entry 1e29

View 1e29 on RCSB PDB site
Description: PSII associated cytochrome C549 from Synechocystis sp.
Class: electron transport
Keywords: electron transport, psii associated cytochrome, cytochrome, low potential, bis_histidinyl, psii modulator
Deposited on 2000-05-19, released 2001-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c549
    Species: SYNECHOCYSTIS SP [TaxId:1143]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e29a_
  • Heterogens: HEC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e29A (A:)
    veltestrtipldeaggtttltarqftngqkifvdtctqchlqgktktnnnvslgladla
    gaeprrdnvlalveflknpksydgeddyselhpnisrpdiypemrnyteddifdvagytl
    iapklderwggtiyf