PDB entry 1e29

View 1e29 on RCSB PDB site
Description: PSII associated cytochrome C549 from Synechocystis sp.
Class: electron transport
Keywords: electron transport, psii associated cytochrome, cytochrome, low potential, bis_histidinyl, psii modulator
Deposited on 2000-05-19, released 2001-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c549
  Species: SYNECHOCYSTIS SP [TaxId:1143]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q55013 (0-134)
  Domains in SCOPe 2.08: d1e29a_
• Heterogens: HEC, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e29A (A:)
  veltestrtipldeaggtttltarqftngqkifvdtctqchlqgktktnnnvslgladla
  gaeprrdnvlalveflknpksydgeddyselhpnisrpdiypemrnyteddifdvagytl
  iapklderwggtiyf