PDB entry 1e26

View 1e26 on RCSB PDB site
Description: design, synthesis and x-ray crystal structure of a potent dual inhibitor of thymidylate synthase and dihydrofolate reductase as an antitumor agent.
Class: oxidoreductase
Keywords: oxidoreductase, dihydrofolate reductase, thymidylate synthase
Deposited on 2000-05-17, released 2001-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Pneumocystis carinii [TaxId:4754]
    Gene: C-DNA P.CARINII DHFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e26a_
  • Heterogens: NAP, GPB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e26A (A:)
    mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
    twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
    fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
    vgtkvphgkinedgfdyefemwtrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e26A (A:)
    nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
    wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
    viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
    gtkvphgkinedgfdyefemwtrdl