PDB entry 1e25

View 1e25 on RCSB PDB site
Description: the high resolution structure of per-1 class a beta-lactamase
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, class a cephalosporinase
Deposited on 2000-05-17, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.14
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: extended-spectrum beta-lactamase per-1
    Species: PSEUDOMONAS AERUGINOSA [TaxId:287]
    Gene: BLAPER-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37321
      • cloning artifact (217)
    Domains in SCOPe 2.07: d1e25a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e25A (A:)
    qspllkeqiesivigkkatvgvavwgpddlepllinpfekfpmqsvfklhlamlvlhqvd
    qgkldlnqtvivnrakvlqntwapimkayqgdefsvpvqqllqysvshsdnvacdllfel
    vggpaalhdyiqsmgiketavvaneaqmhaddqvqyqnwtsmkgaaeilkkfeqktqlse
    tsqallwkwmvetttgperlkgllpagtvvahktgtsqikagktaatndlgiillpdgrp
    llvavfvkdsaessrtneaiiaqvaqtayqfelkklsalspn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e25A (A:)
    spllkeqiesivigkkatvgvavwgpddlepllinpfekfpmqsvfklhlamlvlhqvdq
    gkldlnqtvivnrakvlqntwapimkayqgdefsvpvqqllqysvshsdnvacdllfelv
    ggpaalhdyiqsmgiketavvaneaqmhaddqvqyqnwtsmkgaaeilkkfeqktqlset
    sqallwkwmvetttgperlkgllpagtvvahktgtsqikagktaatndlgiillpdgrpl
    lvavfvkdsaessrtneaiiaqvaqtayqfelkklsal