PDB entry 1e21

View 1e21 on RCSB PDB site
Description: Ribonuclease 1 des1-7 Crystal Structure at 1.9A
Deposited on 2000-05-15, released 2001-05-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-30, with a file datestamp of 2001-08-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1959
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1e21a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e21A (A:)
afqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfqekvtck
ngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasve