PDB entry 1e21

View 1e21 on RCSB PDB site
Description: Ribonuclease 1 des1-7 Crystal Structure at 1.9A
Class: hydrolase
Keywords: human pancreatic ribonuclease, hydrolase
Deposited on 2000-05-15, released 2001-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1959
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07998
      • engineered mutation (6)
    Domains in SCOPe 2.07: d1e21a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e21A (A:)
    kesrakafqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfq
    ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
    dasvedst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e21A (A:)
    afqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplvdvqnvcfqekvtck
    ngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasved