PDB entry 1e1y

View 1e1y on RCSB PDB site
Description: lavopiridol inhibits glycogen phosphorylase by binding at the inhibitor site
Class: glycogen phosphorylase
Keywords: flavopiridol, allosteric inhibition, x-ray crystallography, inhibitor site, glycogen phosphorylase
Deposited on 2000-05-11, released 2000-05-17
The last revision prior to the SCOP 1.75 freeze date was dated 2000-07-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogen phosphorylase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e1ya_
  • Heterogens: GLC, PO3, PLP, CPB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e1yA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1yA (A:)
    sdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlv
    grwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlr
    ygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlw
    sakapngyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksn
    fdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpeale
    rwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlc
    iagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiae
    rigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdv
    qvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklita
    igdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlng
    altigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieql
    ssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirni
    atsgkfssdrtiaqyareiwgvepsrqrlpapd