PDB entry 1e1y

View 1e1y on RCSB PDB site
Description: flavopiridol inhibits glycogen phosphorylase by binding at the inhibitor site
Deposited on 2000-05-11, released 2000-05-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-20, with a file datestamp of .
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e1ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e1yA (A:)
    sdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlv
    grwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlr
    ygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlw
    sakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatl
    qdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdka
    wevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdr
    lrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktn
    gitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklk
    faaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvm
    iggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlse
    qistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqr
    gynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcq
    ervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1yA (A:)
    sdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlv
    grwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlr
    ygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlw
    sakapngyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksn
    fdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpeale
    rwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlc
    iagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiae
    rigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdv
    qvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklita
    igdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlng
    altigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieql
    ssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirni
    atsgkfssdrtiaqyareiwgvepsrqrlpapd