PDB entry 1e1y

View 1e1y on RCSB PDB site
Description: flavopiridol inhibits glycogen phosphorylase by binding at the inhibitor site
Class: transferase
Keywords: allosteric inhibition, transferase
Deposited on 2000-05-11, released 2000-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e1ya_
  • Heterogens: CPB, PO3, GLC, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e1yA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1yA (A:)
    sdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlv
    grwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeelee
    ieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlr
    ygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlw
    sakapngyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksn
    fdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpeale
    rwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlc
    iagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiae
    rigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdv
    qvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklita
    igdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlng
    altigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieql
    ssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirni
    atsgkfssdrtiaqyareiwgvepsrqrlpapd