PDB entry 1e1t

View 1e1t on RCSB PDB site
Description: lysyl-trna synthetase (lysu) hexagonal form complexed with the lysyl_adenylate intermediate
Deposited on 2000-05-10, released 2000-07-28
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-28, with a file datestamp of 2000-07-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.267
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e1tA (A:)
    aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva
    grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt
    qtgelsihctelrlltkalrplpdkfhglqdqevryrqryldliandksrqtfvvrskil
    aairqfmvargfmevetpmmqvipggasarpfithhnaldldmylriapelylkrlvvgg
    fervfeinrnfrnegisvrhnpeftmmelymayadyhdlielteslfrtlaqevlgttkv
    tygehvfdfgkpfekltmreaikkyrpetdmadldnfdaakalaesigitvekswglgri
    vteifdevaeahliqptfiteypaevsplarrndvnpeitdrfeffiggreigngfseln
    daedqaerfqeqvnakaagddeamfydedyvtaleyglpptaglgigidrmimlftnsht
    irdvilfpamrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1tA (A:)
    aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva
    grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt
    qtgelsihctelrlltkalrplpdqevryrqryldliandksrqtfvvrskilaairqfm
    vargfmevetpmmqvipggasarpfithhnaldldmylriapelylkrlvvggfervfei
    nrnfrnegisvrhnpeftmmelymayadyhdlielteslfrtlaqevlgttkvtygehvf
    dfgkpfekltmreaikkyrpetdmadldnfdaakalaesigitvekswglgrivteifde
    vaeahliqptfiteypaevsplarrndvnpeitdrfeffiggreigngfselndaedqae
    rfqeqvnakaagddeamfydedyvtaleyglpptaglgigidrmimlftnshtirdvilf
    pamrp