PDB entry 1e1n

View 1e1n on RCSB PDB site
Description: structure of adrenodoxin reductase at 2.4 angstrom in crystal form a''
Class: oxidoreductase
Keywords: oxidoreductase, flavoenzyme, electron transferase
Deposited on 2000-05-09, released 2000-09-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adrenodoxin reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e1na1, d1e1na2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e1nA (A:)
    stqeqtpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevkn
    vintftqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedhqaldipgeelpgv
    fsarafvgwynglpenrelapdlscdtavilgqgnvaldvarilltppdhlektditeaa
    lgalrqsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpadflglqdrikeaar
    prkrlmelllrtatekpgveeaarrasasrawglrffrspqqvlpspdgrraagirlavt
    rlegigeatravptgdvedlpcglvlssigyksrpidpsvpfdpklgvvpnmegrvvdvp
    glycsgwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsafikalldsrgvw
    pvsfsdwekldaeevsrgqasgkpreklldpqemlrllgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1nA (A:)
    tpqicvvgsgpagfytaqhllkhhsrahvdiyekqlvpfglvrfgvapdhpevknvintf
    tqtarsdrcafygnvevgrdvtvqelqdayhavvlsygaedhqaldipgeelpgvfsara
    fvgwynglpenrelapdlscdtavilgqgnvaldvarilltppdhlektditeaalgalr
    qsrvktvwivgrrgplqvaftikelremiqlpgtrpmldpadflglqdrikeaarprkrl
    melllrtatekpgveeaarrasasrawglrffrspqqvlpspdgrraagirlavtrlegi
    geatravptgdvedlpcglvlssigyksrpidpsvpfdpklgvvpnmegrvvdvpglycs
    gwvkrgptgvitttmtdsfltgqillqdlkaghlpsgprpgsafikalldsrgvwpvsfs
    dwekldaeevsrgqasgkpreklldpqemlrllgh