PDB entry 1e1j

View 1e1j on RCSB PDB site
Description: human prion protein variant m166v
Deposited on 2000-05-09, released 2000-07-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-20, with a file datestamp of 2000-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e1ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e1jA (A:)
    lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpvdeysnqnnfvhdcvniti
    kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr