PDB entry 1e1h

View 1e1h on RCSB PDB site
Description: crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.
Deposited on 2000-05-08, released 2003-06-19
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-06, with a file datestamp of 2004-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1e1h.1
  • Chain 'B':
    Domains in SCOP 1.67: d1e1h.1
  • Chain 'C':
    Domains in SCOP 1.67: d1e1h.2
  • Chain 'D':
    Domains in SCOP 1.67: d1e1h.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e1hA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaykdpvngvdiayik
    ipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakqvpvsyydstylstdne
    kdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgs
    yrseelnlviigpsadiiqfecksfghdvlnltrngygstqyirfspdftfgfeeslevd
    tnpllgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hA (A:)
    maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
    vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
    kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
    fspdftfgfeeslgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e1hB (B:)
    yemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttasl
    qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfd
    kavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hB (B:)
    emsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttaslq
    ymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfdk
    avfrinivpdenytikdgfnlkanlstnfngqnteinsrnftrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e1hC (C:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaykdpvngvdiayik
    ipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakqvpvsyydstylstdne
    kdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgs
    yrseelnlviigpsadiiqfecksfghdvlnltrngygstqyirfspdftfgfeeslevd
    tnpllgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hC (C:)
    maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
    vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
    kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
    fspdftfgfeeslgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e1hD (D:)
    yemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttasl
    qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfd
    kavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hD (D:)
    yemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttasl
    qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfd
    kavfrinivpdenytikdgfnlkanlstnfngqnteinsrnftrl