PDB entry 1e1h

View 1e1h on RCSB PDB site
Description: crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.
Class: hydrolase
Keywords: neurotoxin, zn-endopeptidase, complex, substrate bound, botulinum, inhibitor bound, hydrolase
Deposited on 2000-05-08, released 2003-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type a light chain
    Species: CLOSTRIDIUM BOTULINUM [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E1H (Start-45)
    • Uniprot Q45894 (46-286)
    Domains in SCOPe 2.07: d1e1h.1
  • Chain 'B':
    Compound: botulinum neurotoxin type a light chain
    Species: CLOSTRIDIUM BOTULINUM [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45894 (Start-165)
    • PDB 1E1H
    Domains in SCOPe 2.07: d1e1h.1
  • Chain 'C':
    Compound: botulinum neurotoxin type a light chain
    Species: CLOSTRIDIUM BOTULINUM [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E1H (Start-45)
    • Uniprot Q45894 (46-286)
    Domains in SCOPe 2.07: d1e1h.2
  • Chain 'D':
    Compound: botulinum neurotoxin type a light chain
    Species: CLOSTRIDIUM BOTULINUM [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45894 (0-165)
    • PDB 1E1H
    Domains in SCOPe 2.07: d1e1h.2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e1hA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaykdpvngvdiayik
    ipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakqvpvsyydstylstdne
    kdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgs
    yrseelnlviigpsadiiqfecksfghdvlnltrngygstqyirfspdftfgfeeslevd
    tnpllgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hA (A:)
    maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
    vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
    kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
    fspdftfgfeeslgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e1hB (B:)
    yemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttasl
    qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfd
    kavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hB (B:)
    emsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttaslq
    ymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfdk
    avfrinivpdenytikdgfnlkanlstnfngqnteinsrnftrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e1hC (C:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamaykdpvngvdiayik
    ipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakqvpvsyydstylstdne
    kdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgs
    yrseelnlviigpsadiiqfecksfghdvlnltrngygstqyirfspdftfgfeeslevd
    tnpllgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hC (C:)
    maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
    vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
    kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
    fspdftfgfeeslgagkfatdpavtlahelihaehrlygiainpnrvfkvntnay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e1hD (D:)
    yemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttasl
    qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfd
    kavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1hD (D:)
    yemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttasl
    qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfd
    kavfrinivpdenytikdgfnlkanlstnfngqnteinsrnftrl