PDB entry 1e1g

View 1e1g on RCSB PDB site
Description: human prion protein variant m166v
Class: prion protein
Keywords: prion protein
Deposited on 2000-05-04, released 2000-07-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78446 (0-103)
      • engineered (41)
    Domains in SCOPe 2.01: d1e1ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e1gA (A:)
    lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpvdeysnqnnfvhdcvniti
    kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr