PDB entry 1e1g

View 1e1g on RCSB PDB site
Description: human prion protein variant m166v
Class: prion protein
Keywords: prion protein
Deposited on 2000-05-04, released 2000-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: prion protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P78446 (0-103)
    • engineered (41)
  Domains in SCOPe 2.08: d1e1ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e1gA (A:)
  lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpvdeysnqnnfvhdcvniti
  kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr