PDB entry 1e1c

View 1e1c on RCSB PDB site
Description: METHYLMALONYL-COA MUTASE H244A Mutant
Class: isomerase
Keywords: isomerase, mutase, intramolecular transferase
Deposited on 2000-04-30, released 2000-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylmalonyl-coa mutase alpha chain
    Species: PROPIONIBACTERIUM FREUDENREICHII SUBSP. SHERMANII [TaxId:1752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11653 (0-726)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d1e1ca1, d1e1ca2
  • Chain 'B':
    Compound: methylmalonyl-coa mutase beta chain
    Species: PROPIONIBACTERIUM FREUDENREICHII SUBSP. SHERMANII [TaxId:1752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11652 (Start-636)
      • see remark 999 (201)
      • see remark 999 (328-329)
    Domains in SCOPe 2.07: d1e1cb1, d1e1cb2
  • Chain 'C':
    Compound: methylmalonyl-coa mutase alpha chain
    Species: PROPIONIBACTERIUM FREUDENREICHII SUBSP. SHERMANII [TaxId:1752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11653 (0-726)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d1e1cc1, d1e1cc2
  • Chain 'D':
    Compound: methylmalonyl-coa mutase beta chain
    Species: PROPIONIBACTERIUM FREUDENREICHII SUBSP. SHERMANII [TaxId:1752]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11652 (Start-636)
      • see remark 999 (201)
      • see remark 999 (328-329)
    Domains in SCOPe 2.07: d1e1cd1, d1e1cd2
  • Heterogens: B12, DCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e1cA (A:)
    stlprfdsvdlgnapvpadaarrfeelaakagtgeawetaeqipvgtlfnedvykdmdwl
    dtyagippfvhgpyatmyafrpwtirqyagfstakesnafyrrnlaagqkglsvafdlpt
    hrgydsdnprvagdvgmagvaidsiydmrelfagipldqmsvsmtmngavlpilalyvvt
    aeeqgvkpeqlagtiqndilkefmvrntyiyppqpsmriiseifaytsanmpkwnsisis
    gyamqeagatadiemaytladgvdyiragesvglnvdqfaprlsffwgigmnffmevakl
    raarmlwaklvhqfgpknpksmslrthsqtsgwsltaqdvynnvvrtcieamaatqghtq
    slhtnsldeaialptdfsariarntqlflqqesgttrvidpwsgsayveeltwdlarkaw
    ghiqevekvggmakaiekgipkmrieeaaartqaridsgrqpligvnkyrleheppldvl
    kvdnstvlaeqkaklvklraerdpekvkaaldkitwaagnpddkdpdrnllklcidagra
    matvgemsdalekvfgrytaqirtisgvyskevkntpeveearelveefeqaegrrpril
    lakmgqdghdrgqkviatayadlgfdvdvgplfqtpeetarqaveadvhvvgvsslaggh
    ltlvpalrkeldklgrpdilitvggvipeqdfdelrkdgaveiytpgtvipesaislvkk
    lraslda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e1cB (B:)
    sstdqgtnpadtddltpttlslagdfpkateeqwerevekvlnrgrppekqltfaeclkr
    ltvhtvdgidivpmyrpkdapkklgypgvapftrgttvrngdmdawdvralhedpdekft
    rkaileglergvtslllrvdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvs
    vyersdkpakdlalnlgldpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniy
    hnagagdvaelawalatgaeyvralveqgftateafdtinfrvtathdqfltiarlralr
    eawarigevfgvdedkrgarqnaitswreltredpyvnilrgsiatfsasvggaesittl
    pftqalglpeddfplriarntgivlaeevnigrvndpaggsyyvesltrsladaawkefq
    eveklggmskavmtehvtkvldacnaerakrlanrkqpitavsefpmigarsietkpfpa
    aparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvwhiagid
    tpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalylsgafke
    fgddaaeaeklidgrlfmgmdvvdtlsstldilgvak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1cB (B:)
    tlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpmyrpk
    dapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvtslllr
    vdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlalnlgl
    dpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawalatg
    aeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvdedkrg
    arqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfplria
    rntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmtehvt
    kvldacnaerakrlanrkqpitavsefpmigarsietkpfpaaparkglawhrdsevfeq
    lmdrstsvserpkvflaclgtrrdfggregfsspvwhiagidtpqveggttaeiveafkk
    sgaqvadlcssakvyaqqglevakalkaagakalylsgafkefgddaaeaeklidgrlfm
    gmdvvdtlsstldilgvak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e1cC (C:)
    stlprfdsvdlgnapvpadaarrfeelaakagtgeawetaeqipvgtlfnedvykdmdwl
    dtyagippfvhgpyatmyafrpwtirqyagfstakesnafyrrnlaagqkglsvafdlpt
    hrgydsdnprvagdvgmagvaidsiydmrelfagipldqmsvsmtmngavlpilalyvvt
    aeeqgvkpeqlagtiqndilkefmvrntyiyppqpsmriiseifaytsanmpkwnsisis
    gyamqeagatadiemaytladgvdyiragesvglnvdqfaprlsffwgigmnffmevakl
    raarmlwaklvhqfgpknpksmslrthsqtsgwsltaqdvynnvvrtcieamaatqghtq
    slhtnsldeaialptdfsariarntqlflqqesgttrvidpwsgsayveeltwdlarkaw
    ghiqevekvggmakaiekgipkmrieeaaartqaridsgrqpligvnkyrleheppldvl
    kvdnstvlaeqkaklvklraerdpekvkaaldkitwaagnpddkdpdrnllklcidagra
    matvgemsdalekvfgrytaqirtisgvyskevkntpeveearelveefeqaegrrpril
    lakmgqdghdrgqkviatayadlgfdvdvgplfqtpeetarqaveadvhvvgvsslaggh
    ltlvpalrkeldklgrpdilitvggvipeqdfdelrkdgaveiytpgtvipesaislvkk
    lraslda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e1cD (D:)
    sstdqgtnpadtddltpttlslagdfpkateeqwerevekvlnrgrppekqltfaeclkr
    ltvhtvdgidivpmyrpkdapkklgypgvapftrgttvrngdmdawdvralhedpdekft
    rkaileglergvtslllrvdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvs
    vyersdkpakdlalnlgldpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniy
    hnagagdvaelawalatgaeyvralveqgftateafdtinfrvtathdqfltiarlralr
    eawarigevfgvdedkrgarqnaitswreltredpyvnilrgsiatfsasvggaesittl
    pftqalglpeddfplriarntgivlaeevnigrvndpaggsyyvesltrsladaawkefq
    eveklggmskavmtehvtkvldacnaerakrlanrkqpitavsefpmigarsietkpfpa
    aparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvwhiagid
    tpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalylsgafke
    fgddaaeaeklidgrlfmgmdvvdtlsstldilgvak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e1cD (D:)
    tlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpmyrpk
    dapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvtslllr
    vdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlalnlgl
    dpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawalatg
    aeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvdedkrg
    arqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfplria
    rntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmtehvt
    kvldacnaerakrlanrkqpitavsefpmigarsietkpfpaaparkglawhrdsevfeq
    lmdrstsvserpkvflaclgtrrdfggregfsspvwhiagidtpqveggttaeiveafkk
    sgaqvadlcssakvyaqqglevakalkaagakalylsgafkefgddaaeaeklidgrlfm
    gmdvvdtlsstldilgvak