PDB entry 1e1b

View 1e1b on RCSB PDB site
Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
Class: membrane protein
Keywords: intimin, escherichia coli, cell adhesion, outer membrane protein, nmr spectroscopy
Deposited on 2000-04-28, released 2000-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-06-09, with a file datestamp of 2007-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: intimin
  Species: Escherichia coli
  Gene: EAE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19809 (0-186)
  Domains in SCOPe 2.07: d1e1ba1, d1e1ba2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e1bA (A:)
  tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
  tlkekgtttisvissdnqtatytiatpnslivpnmskrvtyndavntcknfggklpssqn
  elenvfkawgaankyeyykssqtiiswvqqtaqdaksgvastydlvkqnplnnikasesn
  ayatcvk