PDB entry 1e19

View 1e19 on RCSB PDB site
Description: Structure of the carbamate kinase-like carbamoyl phosphate synthetase from the hyperthermophilic archaeon Pyrococcus furiosus bound to ADP
Class: transferase
Keywords: transferase, hyperthermophiles, ADP site, arginine metabolism phosphoryl group transfer
Deposited on 2000-04-28, released 2000-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbamate kinase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e19a_
  • Chain 'B':
    Compound: carbamate kinase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e19b_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e19A (A:)
    mgkrvvialggnalqqrgqkgsyeemmdnvrktarqiaeiiargyevvithgngpqvgsl
    llhmdagqatygipaqpmdvagamsqgwigymiqqalknelrkrgmekkvvtiitqtivd
    kndpafqnptkpvgpfydeetakrlarekgwivkedsgrgwrrvvpspdpkghveaetik
    klvergviviasggggvpviledgeikgveavidkdlageklaeevnadifmiltdvnga
    alyygtekeqwlrevkveelrkyyeeghfkagsmgpkvlaairfiewggeraiiahleka
    vealegktgtqvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e19A (A:)
    gkrvvialggnalqqrgqkgsyeemmdnvrktarqiaeiiargyevvithgngpqvgsll
    lhmdagqatygipaqpmdvagamsqgwigymiqqalknelrkrgmekkvvtiitqtivdk
    ndpafqnptkpvgpfydeetakrlarekgwivkedsgrgwrrvvpspdpkghveaetikk
    lvergviviasggggvpviledgeikgveavidkdlageklaeevnadifmiltdvngaa
    lyygtekeqwlrevkveelrkyyeeghfkagsmgpkvlaairfiewggeraiiahlekav
    ealegktgtqvlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e19B (B:)
    mgkrvvialggnalqqrgqkgsyeemmdnvrktarqiaeiiargyevvithgngpqvgsl
    llhmdagqatygipaqpmdvagamsqgwigymiqqalknelrkrgmekkvvtiitqtivd
    kndpafqnptkpvgpfydeetakrlarekgwivkedsgrgwrrvvpspdpkghveaetik
    klvergviviasggggvpviledgeikgveavidkdlageklaeevnadifmiltdvnga
    alyygtekeqwlrevkveelrkyyeeghfkagsmgpkvlaairfiewggeraiiahleka
    vealegktgtqvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e19B (B:)
    gkrvvialggnalqqrgqkgsyeemmdnvrktarqiaeiiargyevvithgngpqvgsll
    lhmdagqatygipaqpmdvagamsqgwigymiqqalknelrkrgmekkvvtiitqtivdk
    ndpafqnptkpvgpfydeetakrlarekgwivkedsgrgwrrvvpspdpkghveaetikk
    lvergviviasggggvpviledgeikgveavidkdlageklaeevnadifmiltdvngaa
    lyygtekeqwlrevkveelrkyyeeghfkagsmgpkvlaairfiewggeraiiahlekav
    ealegktgtqvlp