PDB entry 1e17

View 1e17 on RCSB PDB site
Description: solution structure of the DNA binding domain of the human forkhead transcription factor afx (foxo4)
Class: DNA binding domain
Keywords: DNA binding domain, winged helix
Deposited on 2000-04-25, released 2000-08-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afx
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E17
      • conflict (47)
    • Uniprot P98177
    Domains in SCOPe 2.05: d1e17a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1e17A (A:)
gsshhhhhhssglvprgshmledpgavtgprkggsrrnawgnqsyaelisqaiesapekr
ltlaqiyewmvrtvpyfkdkgdsnssagwknsirhnlslhskfikvhneatgksswwmln
peggksgkaprrraasmdssskllrgrska

    Sequence, based on observed residues (ATOM records): (download) 
    >1e17A (A:)
srrnawgnqsyaelisqaiesapekrltlaqiyewmvrtvpyfkdkgdsnssagwknsir
hnlslhskfikvhneatgksswwmlnpegg