PDB entry 1e13

View 1e13 on RCSB PDB site
Description: mouse hp1 (m31) c terminal (shadow chromo) domain
Class: chromatin structure
Keywords: chromatin structure, chromo domain, heterochromatin protein 1, protein interaction, homodimer
Deposited on 2000-04-17, released 2000-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2000-06-12, with a file datestamp of 2007-06-01.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modifier 1 protein
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23197 (0-69)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1e13a1, d1e13a2
  • Chain 'B':
    Compound: modifier 1 protein
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23197 (0-69)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1e13b1, d1e13b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e13A (A:)
    kkkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e13A (A:)
    hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e13B (B:)
    kkkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e13B (B:)
    hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
    sfyeerltwh