PDB entry 1e12

View 1e12 on RCSB PDB site
Description: Halorhodopsin, a light-driven chloride pump
Class: transport protein
Keywords: ion pump, chloride pump, membrane protein, retinal protein, lipids, palmitate, haloarchaea, chloride transport, transport protein
Deposited on 2000-04-14, released 2000-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: halorhodopsin
    Species: HALOBACTERIUM SALINARUM [TaxId:2242]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DMH7
      • see remark 999 (207)
    Domains in SCOPe 2.07: d1e12a_
  • Heterogens: CL, K, PLM, OLC, RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e12A (A:)
    avrenallssslwvnvalagiailvfvymgrtirpgrprliwgatlmiplvsissylgll
    sgltvgmiempaghalagemvrsqwgryltwalstpmillalglladvdlgslftviaad
    igmcvtglaaamttsallfrwafyaiscaffvvvlsalvtdwaasassagtaeifdtlrv
    ltvvlwlgypivwavgveglalvqsvgatswaysvldvfakyvfafillrwvannertva
    vagqtlgtmssdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e12A (A:)
    renallssslwvnvalagiailvfvymgrtirpgrprliwgatlmiplvsissylgllsg
    ltvgmiempaghalagemvrsqwgryltwalstpmillalglladvdlgslftviaadig
    mcvtglaaamttsallfrwafyaiscaffvvvlsalvtdwaasassagtaeifdtlrvlt
    vvlwlgypivwavgveglalvqsvgatswaysvldvfakyvfafillrwvannertvav