PDB entry 1e10

View 1e10 on RCSB PDB site
Description: [2fe-2s]-ferredoxin from halobacterium salinarum
Class: iron-sulfur protein
Keywords: iron-sulfur protein, nmr, ferredoxin, halobacterium salinarum, halophilic
Deposited on 2000-04-12, released 2001-04-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: HALOBACTERIUM HALOBIUM [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e10a_
  • Heterogens: ACE, FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e10A (A:)
    ptveylnyetlddqgwdmddddlfekaadagldgedygtmevaegeyileaaeaqgydwp
    fscragacancasivkegeidmdmqqilsdeeveekdvrltcigspaadevkivynakhl
    dylqnrvi