PDB entry 1e0x

View 1e0x on RCSB PDB site
Description: xylanase 10a from sreptomyces lividans. xylobiosyl-enzyme intermediate at 1.65 a
Deposited on 2000-04-10, released 2001-04-05
The last revision prior to the SCOP 1.69 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.126
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1e0xa_
  • Chain 'B':
    Domains in SCOP 1.69: d1e0xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0xA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0xA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0xB (B:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0xB (B:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppa