PDB entry 1e0w

View 1e0w on RCSB PDB site
Description: Xylanase 10A from Sreptomyces lividans. native structure at 1.2 angstrom resolution
Deposited on 2000-04-10, released 2001-04-05
The last revision prior to the SCOP 1.69 freeze date was dated 2001-05-25, with a file datestamp of 2001-05-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.098
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1e0wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0wA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0wA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    ng