PDB entry 1e0v

View 1e0v on RCSB PDB site
Description: xylanase 10a from sreptomyces lividans. cellobiosyl-enzyme intermediate at 1.7 a
Deposited on 2000-04-10, released 2001-04-05
The last revision prior to the SCOP 1.69 freeze date was dated 2001-05-25, with a file datestamp of 2001-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1e0va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0vA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggasseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0vA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    ng