PDB entry 1e0u

View 1e0u on RCSB PDB site
Description: structure r271l mutant of e. coli pyruvate kinase
Class: phosphotransferase
Keywords: phosphotransferase, glycolysis, allostery
Deposited on 2000-04-10, released 2000-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.245
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (270)
      • conflict (278)
    Domains in SCOPe 2.05: d1e0ua1, d1e0ua2, d1e0ua3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (270)
      • conflict (278)
    Domains in SCOPe 2.05: d1e0ub1, d1e0ub2, d1e0ub3
  • Chain 'C':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (270)
      • conflict (278)
    Domains in SCOPe 2.05: d1e0uc1, d1e0uc2, d1e0uc3
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (270)
      • conflict (278)
    Domains in SCOPe 2.05: d1e0ud1, d1e0ud2, d1e0ud3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0uA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0uA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrleiteavcrgavetaekl
    daplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddf
    yrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0uB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0uB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrleiteavcrgavetaekl
    daplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddf
    yrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e0uC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0uC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrleiteavcrgavetaekl
    daplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddf
    yrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e0uD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0uD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekciralkvvitatmmldsmiknprptraeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrleiteavcrgavetaekl
    daplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddf
    yrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl