PDB entry 1e0t

View 1e0t on RCSB PDB site
Description: r292d mutant of e. coli pyruvate kinase
Deposited on 2000-04-10, released 2000-04-11
The last revision prior to the SCOP 1.69 freeze date was dated 2000-07-20, with a file datestamp of 2000-07-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.246
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0tA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0tB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e0tC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e0tD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl