PDB entry 1e0t

View 1e0t on RCSB PDB site
Description: r292d mutant of e. coli pyruvate kinase
Class: phosphotransferase
Keywords: phosphotransferase, glycolysis, allostery
Deposited on 2000-04-10, released 2000-04-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.246
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (291)
      • conflict (278)
    Domains in SCOPe 2.06: d1e0ta1, d1e0ta2, d1e0ta3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (291)
      • conflict (278)
    Domains in SCOPe 2.06: d1e0tb1, d1e0tb2, d1e0tb3
  • Chain 'C':
    Compound: pyruvate kinase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (291)
      • conflict (278)
    Domains in SCOPe 2.06: d1e0tc1, d1e0tc2, d1e0tc3
  • Chain 'D':
    Compound: pyruvate kinase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14178 (0-469)
      • engineered mutation (291)
      • conflict (278)
    Domains in SCOPe 2.06: d1e0td1, d1e0td2, d1e0td3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0tA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tA (A:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0tB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tB (B:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e0tC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tC (C:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e0tD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmmldsmiknprptdaeagdvan
    aildgtdavmlsgesakgkypleavsimaticertdrvmnsrlefnndnrklriteavcr
    gavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlskgvvpqlv
    keitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0tD (D:)
    mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
    aailldtkgpeirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvg
    ntvlvddgligmevtaiegnkvickvlnngdlgenkgvnlpgvsialpalaekdkqdlif
    gceqgvdfvaasfirkrsdvieirehlkahggenihiiskienqeglnnfdeileasdgi
    mvargdlgveipveevifaqkmmiekcirarkvvitatmrptdaeagdvanaildgtdav
    mlsgepleavsimaticertdrvmnsrleiteavcrgavetaekldaplivvatqggksa
    ravrkyfpdatilalttnektahqlvlskgvvpqlvkeitstddfyrlgkelalqsglah
    kgdvvvmvsgalvpsgttntasvhvl