PDB entry 1e0s

View 1e0s on RCSB PDB site
Description: small g protein arf6-GDP
Class: g protein
Keywords: g protein, ras, arf, arf6, membrane traffic
Deposited on 2000-04-06, released 2000-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0sa_
  • Heterogens: GDP, BME, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0sA (A:)
    gkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnv
    wdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifa
    nkqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0sA (A:)
    gkvlskifgnkemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnv
    wdvggqdkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifa
    nkqdlpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk