PDB entry 1e0r

View 1e0r on RCSB PDB site
Description: beta-apical domain of thermosome
Class: chaperonin
Keywords: chaperonin, hsp60, thermosome, tcp1, groEL, thermoplasma acidophilum
Deposited on 2000-04-06, released 2000-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.261
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: thermosome
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48425 (0-153)
      • engineered mutation (0)
      • engineered mutation (150)
      • engineered mutation (153)
    Domains in SCOPe 2.07: d1e0rb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0rB (B:)
    mngiivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenm
    lremvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivst
    ideisssdlgtaerveqvkvgedymtfvtgsknhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0rB (B:)
    mngiivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenm
    lremvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivst
    ideisssdlgtaerveqvkvgedymtfvtgsknh