PDB entry 1e0o

View 1e0o on RCSB PDB site
Description: crystal structure of a ternary fgf1-fgfr2-heparin complex
Class: growth factor
Keywords: growth factor, receptor tyrosine kinase, heparin, ternary complex, signal transduction
Deposited on 2000-04-03, released 2000-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.274
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0oa_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0ob1, d1e0ob2
  • Chain 'C':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0oc_
  • Chain 'D':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e0od1, d1e0od2
  • Heterogens: NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e0oA (A:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0oA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e0oB (B:)
    snnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggy
    kvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanas
    tvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievl
    yirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0oB (B:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhlkvlkaagvnttdkeievlyirnvtfedageytcl
    agnsigisfhsawltvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e0oC (C:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0oC (C:)
    kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
    tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
    ailflplpvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e0oD (D:)
    snnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggy
    kvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanas
    tvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievl
    yirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e0oD (D:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhkvlkaagvnttdkeievlyirnvtfedageytcla
    gnsigisfhsawltvl